Beta Amyloid peptides
Beta Amyloid peptides are processed from the Amyloid Precursor Protein (APP) and are thought to play a role in the development of the senile plaques associated with Alzheimer's Disease. However, it has also been found that Abeta has multiple non-disease activities. Innovagen currently provides a range of these Beta Amyloid peptides and analogues.Beta Amyloid 1-40
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMore details, peptide analogues, modifications, related peptides, etc.
Order Beta Amyloid 1-40 peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-BA40-1 | 180 EUR | BUY | ||||
| 5 mg | SP-BA40-5 | 870 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
Beta Amyloid 1-42
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAMore details, peptide analogues, modifications, related peptides, etc.
Order Beta Amyloid 1-42 peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-BA42-1 | 250 EUR | BUY | ||||
| 5 mg | SP-BA42-5 | 1190 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
Beta Amyloid 29-40
Sequence: GAIIGLMVGGVVMore details, peptide analogues, modifications, related peptides, etc.
Order Beta Amyloid 29-40 peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-BA2940-1 | 70 EUR | BUY | ||||
| 5 mg | SP-BA2940-5 | 260 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
Beta Amyloid 29-42
Sequence: GAIIGLMVGGVVIAMore details, peptide analogues, modifications, related peptides, etc.
Order Beta Amyloid 29-42 peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-BA2942-1 | 290 EUR | BUY | ||||
| 5 mg | SP-BA2942-5 | 640 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||