| Name |
LL-37 Lys 5-TAMRA |
| Sequence |
[LL-37, 37 aa](K-5-TAMRA)-NH2 |
| 3-letter-code |
Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser - (Lys - 5 - TAMRA) -NH2 |
| C-terminus |
Amide |
| Notes |
LL-37 with 5-TAMRA labeled Lysine at C-terminus. |
| Molecular weight |
5032.97 |
| Counter ion |
TFA |
| Solubilization |
Soluble in pure water. |
| Description |
The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). This peptide is labeled with 5-TAMRA via an added Lysine at C-terminus. |
| |
|
|
|
|
|
|
|
