CAP-18 peptide
| Name | CAP-18 | ||||||
| Sequence | GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY | ||||||
| 3-letter-code | Gly - Leu - Arg - Lys - Arg - Leu - Arg - Lys - Phe - Arg - Asn - Lys - Ile - Lys - Glu - Lys - Leu - Lys - Lys - Ile - Gly - Gln - Lys - Ile - Gln - Gly - Leu - Leu - Pro - Lys - Leu - Ala - Pro - Arg - Thr - Asp - Tyr | ||||||
| Molecular weight | 4433.45 | ||||||
| Counter ion | TFA | ||||||
| Solubilization | Soluble in pure water. | ||||||
| Description | CAP-18 is the rabbit homologue of LL-37. | ||||||
| References | Raqib, R., P. Sarker, P. Bergman, G. Ara, M. Lindh, D. A. Sack, K. M. Nasirul Islam, G. H. Gudmundsson, J. Andersson, and B. Agerberth. 2006. Improved outcome in shigellosis associated with butyrate induction of an endogenous peptide antibiotic. Proc. Natl. Acad. Sci. USA 103:9178-9183. |
||||||
Order CAP-18 peptide
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-4541-1 | 300 EUR | BUY | ||||
| 5 mg | SP-4541-5 | 1350 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
CAP-18 antibody
| Information |
|---|
| CAP-18 antibody product description |
