Calcitonin, human peptide

Name Calcitonin, human
Sequence CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2
3-letter-code Cys - Gly - Asn - Leu - Ser - Thr - Cys - Met - Leu - Gly - Thr - Tyr - Thr - Gln - Asp - Phe - Asn - Lys - Phe - His - Thr - Phe - Pro - Gln - Thr - Ala - Ile - Gly - Val - Gly - Ala - Pro -NH2
C-terminus Amide
Disulphide connectivity Cys1-Cys7
Molecular weight 3417.90
               

Please inquire for pricing and availability.

        
Your e-mail address:

Calcitonin, human antibody

Please inquire for pricing and availability.